Database | Recombinant Antibodies And Mimetics Database

What can we help you find?

You are searching for:

Category A

Original source/host: Naïve (human-derived B cell) or synthetic, natural or consensus framework (any species, published framework sequences) antibody or mimetic
Discovery method: Non-immunisation based in vitro display selection of antibody or mimetic
Production: Recombinant expression with no use of animal-derived biomaterials in production or final formulation

Category B

Original source/host: Animal (historic hybridoma) OR naïve, non-immunised animal B cell-derived in vitro antibody display library
Discovery method: immunisation pre-2020 OR in vitro display selection of antibodies
Production: Recombinant expression with no use of animal-derived biomaterials in production or final formulation
Recombinantly reformatted hybridomas are included as they align with the May 2020 EURL ECVAM recommendation, which permits continued use of existing, sequenced, and well-characterised hybridomas to produce recombinant monoclonal antibodies in vitro, as animals are no longer directly involved
Naïve, non-immunised animal B cell-derived in vitro antibody display libraries align with the May 2020 EURL ECVAM recommendation to no longer authorise the development and production of antibodies through animal immunisation

Category C

Original source/host: Naïve (human-derived B cell) or synthetic, natural or consensus framework (any species, published framework sequences) antibody or mimetic
Discovery method: Non-immunisation based in vitro display selection of antibody or mimetic
Production: Recombinant expression ; animal-derived biomaterials used in production or final formulation

Category D

Original source/host: Animal OR naïve, non-immunised animal B cell-derived in vitro antibody display library
Discovery method: immunisation pre-2020 OR in vitro display selection of antibodies
Production: Recombinant expression ; animal-derived biomaterials used in production or final formulation

Category E

Original source/host: Animal
Discovery method: immunisation-based selection post 2020
Production: Recombinant expression with no use of animal-derived biomaterials in production or final formulation

Category F

Original source/host: Animal
Discovery method: immunisation-based selection post 2020
Production: Recombinant expression with animal-derived biomaterials used in production or final formulation

Category G

Original source/host: Unknown
Discovery method: Unknown
Production: Recombinant expression with no use of animal-derived biomaterials in production or final formulation

Uncategorised Antibodies

Uncategorised Antibodies have Antibody/Binder Origins set in such a way as to prevent them from being assigned to a valid Antibody Category.

Click here to view all Antibody Category descriptions and to search directly by Antibody Category

Category A
- Original source/host: Naïve (human-derived B cell) or synthetic, natural or consensus framework (any species, published framework sequences) antibody or mimetic
- Discovery method: Non-immunisation based in vitro display selection of antibody or mimetic
- Production: Recombinant expression with no use of animal-derived biomaterials in production or final formulation
Search
Category B
- Original source/host: Animal (historic hybridoma) OR naïve, non-immunised animal B cell-derived in vitro antibody display library
- Discovery method: immunisation pre-2020 OR in vitro display selection of antibodies
- Production: Recombinant expression with no use of animal-derived biomaterials in production or final formulation
- Recombinantly reformatted hybridomas are included as they align with the May 2020 EURL ECVAM recommendation, which permits continued use of existing, sequenced, and well-characterised hybridomas to produce recombinant monoclonal antibodies in vitro, as animals are no longer directly involved
- Naïve, non-immunised animal B cell-derived in vitro antibody display libraries align with the May 2020 EURL ECVAM recommendation to no longer authorise the development and production of antibodies through animal immunisation
Search
Category C
- Original source/host: Naïve (human-derived B cell) or synthetic, natural or consensus framework (any species, published framework sequences) antibody or mimetic
- Discovery method: Non-immunisation based in vitro display selection of antibody or mimetic
- Production: Recombinant expression ; animal-derived biomaterials used in production or final formulation
Search
Category D
- Original source/host: Animal OR naïve, non-immunised animal B cell-derived in vitro antibody display library
- Discovery method: immunisation pre-2020 OR in vitro display selection of antibodies
- Production: Recombinant expression ; animal-derived biomaterials used in production or final formulation
Search
Category E
- Original source/host: Animal
- Discovery method: immunisation-based selection post 2020
- Production: Recombinant expression with no use of animal-derived biomaterials in production or final formulation
Search
Category F
- Original source/host: Animal
- Discovery method: immunisation-based selection post 2020
- Production: Recombinant expression with animal-derived biomaterials used in production or final formulation
Search
Category G
- Original source/host: Unknown
- Discovery method: Unknown
- Production: Recombinant expression with no use of animal-derived biomaterials in production or final formulation
Search

2361-2370 of 4090 results

Catalogue Number:

RGK26103-100

Category:

Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348)

Target:	Twin-Strep-tag/ Twin Strep tag/ TwinStrep tag/Streptag/Strep tag
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG2b
Host Species:	Mouse
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

RGK25102-100

Category:

Anti-U1RNA Antibody (R2)

Target:	U1 small nuclear RNA/ U1 RNA/ U1 spliceosomal RNA/ U1 snRNA
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG2a/ kappa
Host Species:	Mouse
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

RGK25101-100

Category:

Anti-U1RNA Antibody (R4)

Target:	U1 small nuclear RNA/ U1 RNA/ U1 spliceosomal RNA/ U1 snRNA
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG2a/ kappa
Host Species:	Mouse
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

RGK25103-100

Category:

Anti-U1RNA Antibody (Z5scFv3b)

Target:	U1 small nuclear RNA/ U1 RNA/ U1 spliceosomal RNA/ U1 snRNA
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG2a/ kappa
Host Species:	Mouse
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

RGK25104-100

Category:

Anti-U1RNA Antibody (Z5scFv7b)

Target:	U1 small nuclear RNA/ U1 RNA/ U1 spliceosomal RNA/ U1 snRNA
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG2a/ kappa
Host Species:	Mouse
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

RHC59301-100

Category:

Anti-UBC/polyUb/Polyubiquitin-C Antibody (SAA0328)

Target:	UBC/ Polyubiquitin-C
Species Reactivity:	Human
Type:	Primary Recombinant
Isotype/Mimetic:	IgG2a/ kappa
Host Species:	Mouse
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

RGK26201-100

Category:

Anti-V5 Tag (IPNPLLGLD) Antibody (PK1)

Target:	V5 Tag/ V5-Tag/ V5 Tag (IPNPLLGLD)
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG1/ kappa
Host Species:	Mouse
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

PTX1068

Category:

Anti-V5-Tag Mouse Monoclonal Antibody (Mix)

Target:	Tag
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG1
Host Species:	Other
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

PTX1005

Category:

Anti-V5-Tag Mouse Monoclonal Antibody/ clone 3C8

Target:	Tag
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG1
Host Species:	Other
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Catalogue Number:

PTX1027

Category:

Anti-V5-Tag Mouse Monoclonal Antibody/ clone Q31

Target:	Tag
Species Reactivity:	Other
Type:	Primary Recombinant
Isotype/Mimetic:	IgG1
Host Species:	Other
Animal-Derived Biomaterials Used:	None
Sequence Available	No
Original Discovery Method	Unknown
Original Discovery Information Provided On Datasheet	No
Antibody/Binder Origins:	Unknown discovery source/method, In vitro recombinant expression

Viewing 2361-2370 of 4090 results

Cookie	Duration	Description
cookielawinfo-checkbox-analytics	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Analytics".
cookielawinfo-checkbox-functional	11 months	The cookie is set by GDPR cookie consent to record the user consent for the cookies in the category "Functional".
cookielawinfo-checkbox-necessary	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookies is used to store the user consent for the cookies in the category "Necessary".
cookielawinfo-checkbox-others	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Other.
cookielawinfo-checkbox-performance	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Performance".
viewed_cookie_policy	11 months	The cookie is set by the GDPR Cookie Consent plugin and is used to store whether or not user has consented to the use of cookies. It does not store any personal data.