YP396033

Anti-Twin-Strep-tag Recombinant Antibody (SAA0348)

Order on abinscience.com

Description

The antibody is a Mouse IgG2b targets General Twin-Strep tag

Target

Twin-Strep tag

Target Alias Names

Twin-Strep-tag, Twin Strep tag, TwinStrep tag, Streptag, Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Isotype/Mimetic

IgG2b

Animal-Derived Biomaterials Used

Sequence Available

Original Discovery Method

Unknown

Antibody/Binder Origins

Animal-free discovery, In vitro recombinant expression

Category:	A
Species Reactivity:	Other
Other Species Reactivity:	General
Applications:	ELISA, Western Blot
Type:	Primary Recombinant
Host Species:	Mouse
Formulation:	Sodium-azide free, BSA-free, Carrier-free, Preservative-free, Glycerol-free, Low Endotoxin

Privacy Overview

This website uses cookies to improve your experience while you navigate through the website. Out of these cookies, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may have an effect on your browsing experience.

Necessary

Always Enabled

Necessary cookies are absolutely essential for the website to function properly. These cookies ensure basic functionalities and security features of the website, anonymously.

Cookie	Duration	Description
cookielawinfo-checkbox-analytics	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Analytics".
cookielawinfo-checkbox-functional	11 months	The cookie is set by GDPR cookie consent to record the user consent for the cookies in the category "Functional".
cookielawinfo-checkbox-necessary	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookies is used to store the user consent for the cookies in the category "Necessary".
cookielawinfo-checkbox-others	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Other.
cookielawinfo-checkbox-performance	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Performance".
viewed_cookie_policy	11 months	The cookie is set by the GDPR Cookie Consent plugin and is used to store whether or not user has consented to the use of cookies. It does not store any personal data.

Functional

Performance

Analytics

Others